Iright
BRAND / VENDOR: Proteintech

Proteintech, 26039-1-AP, RTN4RL2 Polyclonal antibody

CATALOG NUMBER: 26039-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RTN4RL2 (26039-1-AP) by Proteintech is a Polyclonal antibody targeting RTN4RL2 in WB, ELISA applications with reactivity to human samples 26039-1-AP targets RTN4RL2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, HeLa cells, K-562 cells, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information RTN4RL2, also named NgR2, may be involved in cell surface receptor signaling pathway, corpus callosum development, and negative regulation of neuron projection development. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23379 Product name: Recombinant human RTN4RL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-420 aa of BC113673 Sequence: FQRARVSSSDVTCATPPERQGRDLRALREADFQACPPAAPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQMCPGAACQAPPDSRGPALSAGLPSPLLCLLLLVPHHL Predict reactive species Full Name: reticulon 4 receptor-like 2 Observed Molecular Weight: 38 kDa GenBank Accession Number: BC113673 Gene Symbol: RTN4RL2 Gene ID (NCBI): 349667 RRID: AB_3669519 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924