Iright
BRAND / VENDOR: Proteintech

Proteintech, 26050-1-AP, Complement factor D Polyclonal antibody

CATALOG NUMBER: 26050-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Complement factor D (26050-1-AP) by Proteintech is a Polyclonal antibody targeting Complement factor D in WB, IHC, ELISA applications with reactivity to human samples 26050-1-AP targets Complement factor D in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue, human placenta tissue, human plasma Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Complement factor D, also known as adipsin, is a highly specific serine protease. Complement factor D is the rate-limiting enzyme in the alternative pathway of complement. It activates C3 convertase by cleaving factor B, which is a key step in the alternative pathway. Complement factor D catalyzes the cleavage of factor B to generate Ba (non-catalytic chain) and Bb (active catalytic subunit), which together with C3(H2O) (or C3b) constitute the active C3 convertase C3(H2O)Bb (or C3bBb). (PMID: 34566967; PMID: 27775713). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23473 Product name: Recombinant human CFD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 87-201 aa of BC057807 Sequence: QPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRR Predict reactive species Full Name: complement factor D (adipsin) Calculated Molecular Weight: 253 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC057807 Gene Symbol: CFD Gene ID (NCBI): 1675 RRID: AB_2880352 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00746 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924