Proteintech, 26053-1-AP, Moesin Polyclonal antibody

Size: 20ul / 150ul The Moesin (26053-1-AP) by Proteintech is a Polyclonal antibody targeting Moesin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26053-1-AP targets Moesin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, Neuro-2a cells, C6 cells, mouse heart tissue, mouse lung tissue, rat heart tissue Positive IHC detected in: human colon tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Moesin belongs to the ezrin-radixin-moesin (ERM) family of proteins which act as cross-linkers between membrane and actin cytoskeleton. ERM proteins provide structural links to strengthen the cell cortex and facilitate several key cellular processes, including membrane dynamics, substrate adhesion, cell survival, cell adhesion, and motility. The function of ERM proteins is highly reliant on phosphorylation induced conformational changes in response to growth factor, chemokine, and antigen stimulation. This antibody may cross-react with ezrin or radixin with molecular weights around 68-70 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23531 Product name: Recombinant human MSN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 385-502 aa of BC017293 Sequence: EAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKD Predict reactive species Full Name: moesin Calculated Molecular Weight: 577 aa, 68 kDa Observed Molecular Weight: 68-70 kDa GenBank Accession Number: BC017293 Gene Symbol: Moesin Gene ID (NCBI): 4478 RRID: AB_2880353 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P26038 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.