Proteintech, 26060-1-AP, SLFN11 Polyclonal antibody

Size: 20ul / 150ul The SLFN11 (26060-1-AP) by Proteintech is a Polyclonal antibody targeting SLFN11 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 26060-1-AP targets SLFN11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, HEK-293 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag22030 Product name: Recombinant human SLFN11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 735-796 aa of BC052586 Sequence: DPIAKYLQKEMQVIRSNPSFNIPTGCLEVFPEAEWSQGVQGTLRIKKYLTVEQIMTCVADTC Predict reactive species Full Name: schlafen family member 11 Calculated Molecular Weight: 901 aa, 103 kDa Observed Molecular Weight: 103 kDa GenBank Accession Number: BC052586 Gene Symbol: SLFN11 Gene ID (NCBI): 91607 RRID: AB_2880356 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z7L1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.