Proteintech, 26075-1-AP, RLN3 Polyclonal antibody

Size: 20ul / 150ul The RLN3 (26075-1-AP) by Proteintech is a Polyclonal antibody targeting RLN3 in IHC, ELISA applications with reactivity to human, mouse samples 26075-1-AP targets RLN3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23382 Product name: Recombinant human RLN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-142 aa of BC140935 Sequence: AAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPVVLRGSRDVLAGLSSSCCKWGCSKSEISSLC Predict reactive species Full Name: relaxin 3 GenBank Accession Number: BC140935 Gene Symbol: RLN3 Gene ID (NCBI): 117579 RRID: AB_2880364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXF3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.