Iright
BRAND / VENDOR: Proteintech

Proteintech, 26077-1-AP, CLEC12B Polyclonal antibody

CATALOG NUMBER: 26077-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CLEC12B (26077-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC12B in WB, ELISA applications with reactivity to human, mouse, rat samples 26077-1-AP targets CLEC12B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, K-562 cells, mouse spleen tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CLEC12B (C-type lectin domain family 12 member B) is a single-pass type II membrane protein of the C-type lectin-like family. CLEC12B acts as an inhibitory receptor on myeloid cells. CLEC12B may be involved in limiting the activity of monocyte-derived immune cells after cell differentiation and possibly during inflammatory diseases. (PMID: 17562706) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23396 Product name: Recombinant human CLEC12B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 65-232 aa of BC136805 Sequence: LQISNDINSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSLLKRQEQMAIKLCQELIIHTSDHRCNPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDSSGRSWFWEDGSVPSPSLYVSNY Predict reactive species Full Name: C-type lectin domain family 12, member B Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC136805 Gene Symbol: CLEC12B Gene ID (NCBI): 387837 RRID: AB_2880365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2HXU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924