Proteintech, 26086-1-AP, C16orf61 Polyclonal antibody

Size: 20ul / 150ul The C16orf61 (26086-1-AP) by Proteintech is a Polyclonal antibody targeting C16orf61 in WB, ELISA applications with reactivity to human samples 26086-1-AP targets C16orf61 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, human kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The function of C16orf61 remains largely unknown. It may be involved in cytochrome c oxidase biogenesis. Catalog#26086-1-AP is a rabbit polyclonal antibody raised against the full-length of human C16orf61. The MW of this protein is 9 kDa, and this antibody specially recognises the 9 kDa protein. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23319 Product name: Recombinant human C16orf61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC032631 Sequence: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESEK Predict reactive species Full Name: chromosome 16 open reading frame 61 Observed Molecular Weight: 9 kDa GenBank Accession Number: BC032631 Gene Symbol: C16orf61 Gene ID (NCBI): 56942 RRID: AB_2880369 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.