Iright
BRAND / VENDOR: Proteintech

Proteintech, 26101-1-AP, PLGRKT Polyclonal antibody

CATALOG NUMBER: 26101-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PLGRKT (26101-1-AP) by Proteintech is a Polyclonal antibody targeting PLGRKT in WB, ELISA applications with reactivity to human, mouse, rat samples 26101-1-AP targets PLGRKT in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, J774A.1 cells, SH-SY5Y cells, PC-12 cells, RAW 264.7 cells, mouse colon tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23410 Product name: Recombinant human C9orf46 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-147 aa of BC008212 Sequence: MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK Predict reactive species Full Name: chromosome 9 open reading frame 46 Observed Molecular Weight: 17 kDa GenBank Accession Number: BC008212 Gene Symbol: PLGRKT Gene ID (NCBI): 55848 RRID: AB_2880377 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924