Proteintech, 26141-1-AP, C14orf119 Polyclonal antibody

Size: 20ul / 150ul The C14orf119 (26141-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf119 in WB, ELISA applications with reactivity to human samples 26141-1-AP targets C14orf119 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23415 Product name: Recombinant human C14orf119 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC009645 Sequence: MPLESSSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLEDLVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEFSEPDFVAKFYQAVAATAGKD Predict reactive species Full Name: chromosome 14 open reading frame 119 Observed Molecular Weight: 13-16 kDa GenBank Accession Number: BC009645 Gene Symbol: C14orf119 Gene ID (NCBI): 55017 RRID: AB_2880399 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWQ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.