Proteintech, 26144-1-AP, RNF144A Polyclonal antibody

Size: 20ul / 150ul The RNF144A (26144-1-AP) by Proteintech is a Polyclonal antibody targeting RNF144A in WB, IP, ELISA applications with reactivity to human, hamster samples 26144-1-AP targets RNF144A in WB, IP, ELISA applications and shows reactivity with human, hamster samples. Tested Applications Positive WB detected in: MDA-MB-231 cells Positive IP detected in: CHO cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information RNF144A (Ring Finger protein 144A) as the first E3 ubiquitin ligase for cytosolic DNA-PKcs, is induced in a p53-dependent manner during DNA damage and targets cytosolic DNA-PKcs for ubiquitination and degradation. RNF144A is an RBR-containing protein, and is unstable and degraded through the proteasome-dependent pathway (PMID: 24979766). RNF144A contains an RBR domain in the N-terminus and a potential single-transmembrane (TM) domain in the C-terminus, and is distributed in both plasma membrane and the membranes of intracellular vesicles including endosomes, lysosomes, endoplasmic reticulum (ER), perinuclear vesicles, and others, which might be caused by the presence of the TM domain (PMID: 37955227). Specification Tested Reactivity: human, hamster Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23508 Product name: Recombinant human RNF144A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-179 aa of BC050373 Sequence: ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD Predict reactive species Full Name: ring finger protein 144A Observed Molecular Weight: 33 kDa GenBank Accession Number: BC050373 Gene Symbol: RNF144A Gene ID (NCBI): 9781 RRID: AB_2880402 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50876 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.