Proteintech, 26145-1-AP, C2orf60 Polyclonal antibody

Size: 20ul / 150ul The C2orf60 (26145-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf60 in WB, ELISA applications with reactivity to human samples 26145-1-AP targets C2orf60 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23452 Product name: Recombinant human C2orf60 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 175-315 aa of BC136837 Sequence: KRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE Predict reactive species Full Name: chromosome 2 open reading frame 60 Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC136837 Gene Symbol: C2orf60 Gene ID (NCBI): 129450 RRID: AB_2880403 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A2RUC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.