Product Description
Size: 20ul / 150ul
The C2orf60 (26145-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf60 in WB, ELISA applications with reactivity to human samples
26145-1-AP targets C2orf60 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Jurkat cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23452 Product name: Recombinant human C2orf60 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 175-315 aa of BC136837 Sequence: KRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMVLHIQDKAYSKNSE Predict reactive species
Full Name: chromosome 2 open reading frame 60
Observed Molecular Weight: 40-45 kDa
GenBank Accession Number: BC136837
Gene Symbol: C2orf60
Gene ID (NCBI): 129450
RRID: AB_2880403
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: A2RUC4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924