Proteintech, 26149-1-AP, Cytokeratin 71 Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 71 (26149-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 71 in WB, ELISA applications with reactivity to human, mouse samples 26149-1-AP targets Cytokeratin 71 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skin tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information KRT71 is a gene that encodes Keratin 71, a type II intermediate filament protein primarily expressed in the inner root sheath (IRS) of hair follicles. As a member of the keratin family, KRT71 plays a critical role in maintaining the structural integrity of hair shafts and follicular tissues. Mutations in this gene have been linked to hereditary hair disorders, including autosomal recessive woolly hair (ARWH) and hypotrichosis, characterized by abnormal hair texture, density, or growth patterns. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23536 Product name: Recombinant human KRT71 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 450-523 aa of BC103917 Sequence: PVSISIISSTSGGSGYGFRPSMVSGGYVANSSNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR Predict reactive species Full Name: keratin 71 Observed Molecular Weight: 57 kDa GenBank Accession Number: BC103917 Gene Symbol: KRT71 Gene ID (NCBI): 112802 RRID: AB_3085843 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3SY84 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.