Proteintech, 26150-1-AP, NBCe2 Polyclonal antibody

Size: 20ul / 150ul The NBCe2 (26150-1-AP) by Proteintech is a Polyclonal antibody targeting NBCe2 in IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse samples 26150-1-AP targets NBCe2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive IHC detected in: human liver cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information NBCe2, also named as SLC4A5 and NBC4, belongs to the anion exchanger (TC 2.A.31) family. NBCe2 mediates electrogenic Na+:HCO3 − transport, and can operate in both a 1:2, and 1:3 manner, but the transport stoichiometry as well as directionality have not been defined for the renal NBCe2. The expression of NBCe2 has been reported in nearly all kidney nephron segments and CDs, indicating that some species-specificity might be present (PMID: 32547422). NBCe2 has 8 isoforms with the molecular mass of 108-127 kDa. Specification Tested Reactivity: Human, Mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23558 Product name: Recombinant human SLC4A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 953-1019 aa of BC109221 Sequence: NILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL Predict reactive species Full Name: solute carrier family 4, sodium bicarbonate cotransporter, member 5 Observed Molecular Weight: 108-127 kDa GenBank Accession Number: BC109221 Gene Symbol: SLC4A5 Gene ID (NCBI): 57835 RRID: AB_2918099 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BY07 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.