Proteintech, 26163-1-AP, IL-17a Polyclonal antibody

Size: 20ul / 150ul The IL-17a (26163-1-AP) by Proteintech is a Polyclonal antibody targeting IL-17a in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 26163-1-AP targets IL-17a in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PMA, Ionomycin and Brefeldin A treated EL-4 cells Positive IHC detected in: mouse spleen tissue, human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The IL17A monomer is a peptide consisting of 155 amino acids. The IL17A peptide comprises a 23 amino acid signal peptide and a 132 amino acid mature peptide. The IL17A homodimer has a molecular weight of 35 kD (Kolls and Lindén, 2004). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24087 Product name: Recombinant mouse IL-17A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-158 aa of NM-010552 Sequence: AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA Predict reactive species Full Name: interleukin 17A Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 15kDa,17 kDa GenBank Accession Number: NM-010552 Gene Symbol: Il17a Gene ID (NCBI): 16171 RRID: AB_2880409 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q62386 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.