Proteintech, 26174-1-AP, CD28 Polyclonal antibody

Size: 20ul / 150ul The CD28 (26174-1-AP) by Proteintech is a Polyclonal antibody targeting CD28 in IP, IHC, ELISA applications with reactivity to human samples 26174-1-AP targets CD28 in IP, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Jurkat cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CD28 (T-cell-specific surface glycoprotein CD28), also known as T44 and Tp44, is a 44 kD disulfide-linked homodimeric type I glycoprotein (PMID: 2162180). It is a member of the immunoglobulin superfamily and is expressed on most T lineage cells, NK cell subsets, and plasma cells (PMID: 2162180, 8386518). CD28 may affect in vivo immune responses by functioning both as a cell adhesion molecule linking B and T lymphocytes and as the surface component of a novel signal transduction pathway (PMID: 2162180, 3021470). CD28 binds both CD80 and CD86 with a highly conserved motif MYPPY in the CDR3-like loop (PMID: 15696168, 7964482). CD28 is considered a major co-stimulatory molecule, inducing T lymphocyte activation and IL-2 synthesis, and preventing cell death (PMID: 1348520). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24058 Product name: Recombinant human CD28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-220 aa of BC093698 Sequence: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS Predict reactive species Full Name: CD28 molecule Calculated Molecular Weight: 220 aa, 25 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC093698 Gene Symbol: CD28 Gene ID (NCBI): 940 ENSEMBL Gene ID: ENSG00000178562 RRID: AB_3669525 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10747 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.