Proteintech, 26185-1-AP, GLDN Polyclonal antibody

Size: 20ul / 150ul The GLDN (26185-1-AP) by Proteintech is a Polyclonal antibody targeting GLDN in WB, IHC, ELISA applications with reactivity to human, mouse samples 26185-1-AP targets GLDN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24247 Product name: Recombinant human GLDN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-110 aa of BC113399 Sequence: MVDLCNSTKGICLTGPSGPPGPPGAGGLPGHNGLDGQPGPQGPKGEKGANGKRGKMGIPGAAGNPGERGEKGDHGELGLQGNEGPPGQKGEKGDKGDVSNDVLLAGAKGD Predict reactive species Full Name: gliomedin Calculated Molecular Weight: 551 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC113399 Gene Symbol: GLDN Gene ID (NCBI): 342035 RRID: AB_2880416 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZMI3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.