Iright
BRAND / VENDOR: Proteintech

Proteintech, 26190-1-AP, SAPS2 Polyclonal antibody

CATALOG NUMBER: 26190-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SAPS2 (26190-1-AP) by Proteintech is a Polyclonal antibody targeting SAPS2 in WB, IHC, ELISA applications with reactivity to human samples 26190-1-AP targets SAPS2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SAPS2 is a regulatory protein for the protein phosphatase-6 catalytic subunit. Together, these proteins act as a significant T-loop phosphatase for Aurora A, an essential mitotic kinase. Loss of function of either the regulatory or catalytic subunit of protein phosphatase-6 interferes with spindle formation and chromosome alignment. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23458 Product name: Recombinant human SAPS2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 617-966 aa of BC000976 Sequence: ALFEACCSDRIQPFDDDEDEDIWEDSDTRCAARVMARPRFGAPHASESCSKNGPERGGQDGKASLEAHRDAPGAGAPPAPGKKEAPPVEGDSEGAMWTAVFDEPANSTPTAPGVVRDVGSSVWAAGTSAPEEKGWAKFTDFQPFCCSESGPRCSSPVDTECSHAEGSRSQGPEKASQASYFAVSPASPCAWNVCVTRKAPLLASDSSSSGGSHSEDGDQKAASAMDAVSRGPGREAPPLPTVARTEEAVGRVGCADSRLLSPACPAPKEVTAAPAVAVPPEATVAITTALSKAGPAIPTPAVSSALAVAVPLGPIMAVTAAPAMVATLGTVTKDGKTDAPPEGAALNGPV Predict reactive species Full Name: SAPS domain family, member 2 Calculated Molecular Weight: 105 kDa Observed Molecular Weight: 115-125 kDa GenBank Accession Number: BC000976 Gene Symbol: SAPS2 Gene ID (NCBI): 9701 RRID: AB_3085847 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75170 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924