Iright
BRAND / VENDOR: Proteintech

Proteintech, 26201-1-AP, Unc119b Polyclonal antibody

CATALOG NUMBER: 26201-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Unc119b (26201-1-AP) by Proteintech is a Polyclonal antibody targeting Unc119b in WB, IF/ICC, ELISA applications with reactivity to human, mouse, Canine samples 26201-1-AP targets Unc119b in WB, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, Canine samples. Tested Applications Positive WB detected in: A549 cells, MDCK cells, mouse kidney tissue, HEK-293 cells, HeLa cells Positive IF/ICC detected in: MDCK cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mouse Unc119b is related closely to Unc119, a homolog of C. elegans unc119 protein which was first discovered in C. elegans on the basis of a spontaneous mutation affecting locomotion, feeding behavior and chemosensation. Mouse Unc119b shares 90% sequence identity with human UNC119b protein. UNC119b is a myristoyl-binding protein that acts as a cargo adapter: specifically binds the myristoyl moiety of a subset of N-terminally myristoylated proteins and is required for their localization. Myristoyl-binding activity of UNC119b is required to localize NPHP3 to the primary cilium (PMID: 22085962). Specification Tested Reactivity: human, mouse, Canine Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24599 Product name: Recombinant mouse Unc119b protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-251 aa of BC008617 Sequence: MSGSNPKAATAGSQAGPGGLVAGKEEKKKAGGGVLNRLKARRQGPPHTPDDGSGAAVTEQELLALDTIRPEHVLRLNRVTENYLCKPEDNVYSIDFTRFKIRDLETGTVLFEIAKPCISDQDQDAEEESVDVDISVGRFVRYQFTPAFLRLRTVGATVEFTVGDRPVTGFRMIERHYFRERLLKTFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLVMHNKADYAYNGGQ Predict reactive species Full Name: unc-119 homolog B (C. elegans) Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-31 kDa GenBank Accession Number: BC008617 Gene Symbol: Unc119b Gene ID (NCBI): 106840 RRID: AB_2880422 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8C4B4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924