Product Description
Size: 20ul / 150ul
The SOCS2 (26206-1-AP) by Proteintech is a Polyclonal antibody targeting SOCS2 in WB, ELISA applications with reactivity to human, rat samples
26206-1-AP targets SOCS2 in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Applications
Positive WB detected in: K-562 cells, PC-12 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:3000
Background Information
SOCS2 is the substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as EPOR and GHR (PMID: 11781573; 21980433; 25505247; 31182716; 34857742).
Specification
Tested Reactivity: human, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24394 Product name: Recombinant human SOCS2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 89-198 aa of BC010399 Sequence: SAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV Predict reactive species
Full Name: suppressor of cytokine signaling 2
Calculated Molecular Weight: 198 aa, 22 kDa
Observed Molecular Weight: 20-23 kDa
GenBank Accession Number: BC010399
Gene Symbol: SOCS2
Gene ID (NCBI): 8835
RRID: AB_3669527
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O14508
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924