Iright
BRAND / VENDOR: Proteintech

Proteintech, 26214-1-AP, DBF4B Polyclonal antibody

CATALOG NUMBER: 26214-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DBF4B (26214-1-AP) by Proteintech is a Polyclonal antibody targeting DBF4B in WB, ELISA applications with reactivity to human samples 26214-1-AP targets DBF4B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, T-47D cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cell-cycle progression is driven by orderly activation of many kinases including the DBF4/DBF4B-dependent S-phase promoting kinase Cdc7. Binding of Cdc7 to its subunit DBF4 or DBF4B (also known as DRF1/ASKL1) is thought to be a key regulatory event that controls Cdc7 activity in human cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23889 Product name: Recombinant human DBF4B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 60-297 aa of BC016158 Sequence: GKNLQFLTGAIQQLGGVIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQKAIRNQGSISGGGSGGSSSLLTNARSWGVRILHVDEMMMHVQQLSLASLCVKKQQPKKPEGTCPAAESRTRKVARLKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRK Predict reactive species Full Name: DBF4 homolog B (S. cerevisiae) Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC016158 Gene Symbol: DBF4B Gene ID (NCBI): 80174 RRID: AB_3669528 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924