Proteintech, 26216-1-AP, ZNF202 Polyclonal antibody

Size: 20ul / 150ul The ZNF202 (26216-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF202 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26216-1-AP targets ZNF202 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, human testis tissue, mouse spermatophore tissue, HeLa cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ZNF202 gene product is a transcriptional repressor that binds to elements found predominantly in genes that participate in lipid metabolism. Among its targets are structural components of lipoprotein particles (apolipoproteins AIV, CIII, and E), enzymes involved in lipid processing (lipoprotein lipase, lecithin cholesteryl ester transferase), and several genes involved in processes related to energy metabolism and vascular disease (PMID: 10748193). ZNF202 is expressed in two common splice variants. The α protein consists of 424 amino acids, while the β-protein consists of 648 amino acids (PMID: 11279031). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23859 Product name: Recombinant human ZNF202 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 239-416 aa of BC013382 Sequence: FKDVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRPDEISQVREEEPWVPDIQEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCSVCGKSFTCNSHLVRHL Predict reactive species Full Name: zinc finger protein 202 Observed Molecular Weight: 49 kDa GenBank Accession Number: BC013382 Gene Symbol: ZNF202 Gene ID (NCBI): 7753 RRID: AB_3669529 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95125 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.