Product Description
Size: 20ul / 150ul
The ASPM (26223-1-AP) by Proteintech is a Polyclonal antibody targeting ASPM in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
26223-1-AP targets ASPM in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293T cells, K-562 cells
Positive IHC detected in: human prostate cancer tissue, human gliomas tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600
Specification
Tested Reactivity: human
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24166 Product name: Recombinant human ASPM protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-95 aa of BC034607 Sequence: MSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLEDNSDVT Predict reactive species
Full Name: asp (abnormal spindle) homolog, microcephaly associated (Drosophila)
Calculated Molecular Weight: 410 kDa or 218 kDa
Observed Molecular Weight: 218 kDa
GenBank Accession Number: BC034607
Gene Symbol: ASPM
Gene ID (NCBI): 259266
RRID: AB_2880431
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8IZT6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924