Iright
BRAND / VENDOR: Proteintech

Proteintech, 26223-1-AP, ASPM Polyclonal antibody

CATALOG NUMBER: 26223-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ASPM (26223-1-AP) by Proteintech is a Polyclonal antibody targeting ASPM in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 26223-1-AP targets ASPM in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, K-562 cells Positive IHC detected in: human prostate cancer tissue, human gliomas tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24166 Product name: Recombinant human ASPM protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-95 aa of BC034607 Sequence: MSLRAYTARCRLNRLRRAACRLFTSEKMVKAIKKLEIEIEARRLIVRKDRHLWKDVGERQKVLNWLLSYNPLWLRIGLETTYGELISLEDNSDVT Predict reactive species Full Name: asp (abnormal spindle) homolog, microcephaly associated (Drosophila) Calculated Molecular Weight: 410 kDa or 218 kDa Observed Molecular Weight: 218 kDa GenBank Accession Number: BC034607 Gene Symbol: ASPM Gene ID (NCBI): 259266 RRID: AB_2880431 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IZT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924