Proteintech, 26233-1-AP, FAHD1 Polyclonal antibody

Size: 20ul / 150ul The FAHD1 (26233-1-AP) by Proteintech is a Polyclonal antibody targeting FAHD1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 26233-1-AP targets FAHD1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, HeLa cells Positive IP detected in: mouse kidney tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23966 Product name: Recombinant human FAHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-226 aa of BC063017 Sequence: ADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLPKVSSATLPVRLQE Predict reactive species Full Name: fumarylacetoacetate hydrolase domain containing 1 Observed Molecular Weight: 27 Kda GenBank Accession Number: BC063017 Gene Symbol: FAHD1 Gene ID (NCBI): 81889 RRID: AB_2880436 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P587 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.