Proteintech, 26235-1-AP, FGF13 Polyclonal antibody

Size: 20ul / 150ul The FGF13 (26235-1-AP) by Proteintech is a Polyclonal antibody targeting FGF13 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26235-1-AP targets FGF13 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FGF13 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This gene is located in a region on chromosome X, which is associated with Borjeson-Forssman-Lehmann syndrome (BFLS), making it a possible candidate gene for familial cases of the BFLS, and for other syndromal and nonspecific forms of X-linked mental retardation mapping to this region. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23965 Product name: Recombinant human FGF13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 212-245 aa of BC034340 Sequence: LTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST Predict reactive species Full Name: fibroblast growth factor 13 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC034340 Gene Symbol: FGF13 Gene ID (NCBI): 2258 RRID: AB_2880438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92913 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.