Proteintech, 26242-1-AP, NT5DC3 Polyclonal antibody

Size: 20ul / 150ul The NT5DC3 (26242-1-AP) by Proteintech is a Polyclonal antibody targeting NT5DC3 in IP, ELISA applications with reactivity to human, mouse samples 26242-1-AP targets NT5DC3 in IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IP detected in: mouse testis tissue, HepG2 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23962 Product name: Recombinant human NT5DC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC052293 Sequence: MTMAAAAVVARGAGARAATAAALRGGCGTAARGRPCAGPARPLCTAPGTAPDMKRYLWERYREAKRSTEELVPSIMSNLLNPDAIFSNNEMSLSDIEI Predict reactive species Full Name: 5'-nucleotidase domain containing 3 Observed Molecular Weight: 63 kDa GenBank Accession Number: BC052293 Gene Symbol: NT5DC3 Gene ID (NCBI): 51559 RRID: AB_2880442 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.