Iright
BRAND / VENDOR: Proteintech

Proteintech, 26247-1-AP, GIT1 Polyclonal antibody

CATALOG NUMBER: 26247-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GIT1 (26247-1-AP) by Proteintech is a Polyclonal antibody targeting GIT1 in WB, ELISA applications with reactivity to human, rat samples 26247-1-AP targets GIT1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: ROS1728 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GIT1 (ARF GTPase-activating protein GIT1) is a member of the GIT subfamily of ADP ribosylation factor (ARF)-GTPase activating protein (GAP) family of proteins, which are characterized by an ARFGAP domain that stimulates the GTPase activity of proteins. GIT1 was highly expressed in the nervous system, and its expression was maintained throughout all brain neuritogenesis stages (PMID: 27127481). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24648 Product name: Recombinant human GIT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 471-640 aa of BC067358 Sequence: LRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP Predict reactive species Full Name: G protein-coupled receptor kinase interacting ArfGAP 1 Calculated Molecular Weight: 694 aa, 77 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC067358 Gene Symbol: GIT1 Gene ID (NCBI): 28964 RRID: AB_2880445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924