Proteintech, 26260-1-AP, C13orf39 Polyclonal antibody

Size: 20ul / 150ul The C13orf39 (26260-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf39 in WB, ELISA applications with reactivity to human, rat samples 26260-1-AP targets C13orf39 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23418 Product name: Recombinant human C13orf39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-264 aa of BC132748 Sequence: NTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWD Predict reactive species Full Name: chromosome 13 open reading frame 39 Observed Molecular Weight: 29 kDa GenBank Accession Number: BC132748 Gene Symbol: C13orf39 Gene ID (NCBI): 196541 RRID: AB_3669531 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VZV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.