Proteintech, 26288-1-AP, ZNF385A Polyclonal antibody

Size: 20ul / 150ul The ZNF385A (26288-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF385A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26288-1-AP targets ZNF385A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human brown diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HaCaT cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23577 Product name: Recombinant human ZNF385A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 76-172 aa of BC029752 Sequence: NRHARRVKGIEAAKTRGREPGVREPGDPAPPGSTPTNGDGVAPRPVSMENGLGPAPGSPEKQPGSPSPPSIPETGQGVTKGEGGTPAPASLPGGSKE Predict reactive species Full Name: zinc finger protein 385A Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC029752 Gene Symbol: ZNF385A Gene ID (NCBI): 25946 RRID: AB_2880464 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.