Proteintech, 26292-1-AP, SLC25A47 Polyclonal antibody

Size: 20ul / 150ul The SLC25A47 (26292-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A47 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 26292-1-AP targets SLC25A47 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23376 Product name: Recombinant human C14orf68 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-188 aa of BC137253 Sequence: EVAKVRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYKGSSALVLR Predict reactive species Full Name: chromosome 14 open reading frame 68 GenBank Accession Number: BC137253 Gene Symbol: SLC25A47 Gene ID (NCBI): 283600 RRID: AB_2880465 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6Q0C1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.