Product Description
Size: 20ul / 150ul
The CCDC21 (26314-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC21 in WB, ELISA applications with reactivity to human samples
26314-1-AP targets CCDC21 in WB, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, Jurkat cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
CCDC21, also named as CEP85, is a Centrosomal protein with MW 85 kDa. All the isoforms of CCDC21 can be detected by this antibody.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23636 Product name: Recombinant human CCDC21 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 569-687 aa of BC064528 Sequence: MESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGSPPSPDTAQLALELHQELASCLQDLQAV Predict reactive species
Full Name: coiled-coil domain containing 21
Observed Molecular Weight: 85-90 kDa
GenBank Accession Number: BC064528
Gene Symbol: CCDC21
Gene ID (NCBI): 64793
RRID: AB_2880475
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q6P2H3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924