Iright
BRAND / VENDOR: Proteintech

Proteintech, 26314-1-AP, CCDC21 Polyclonal antibody

CATALOG NUMBER: 26314-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCDC21 (26314-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC21 in WB, ELISA applications with reactivity to human samples 26314-1-AP targets CCDC21 in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CCDC21, also named as CEP85, is a Centrosomal protein with MW 85 kDa. All the isoforms of CCDC21 can be detected by this antibody. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23636 Product name: Recombinant human CCDC21 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 569-687 aa of BC064528 Sequence: MESWQKRYDSLQKIVEKQQQKMDQLRSQVQSLEQEVAQEEGTSQALREEAQRRDSALQQLRTAVKELSVQNQDLIEKNLTLQEHLRQAQPGSPPSPDTAQLALELHQELASCLQDLQAV Predict reactive species Full Name: coiled-coil domain containing 21 Observed Molecular Weight: 85-90 kDa GenBank Accession Number: BC064528 Gene Symbol: CCDC21 Gene ID (NCBI): 64793 RRID: AB_2880475 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P2H3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924