Proteintech, 26317-1-AP, LRRCC1 Polyclonal antibody

Size: 20ul / 150ul The LRRCC1 (26317-1-AP) by Proteintech is a Polyclonal antibody targeting LRRCC1 in IHC, ELISA applications with reactivity to Mouse, human samples 26317-1-AP targets LRRCC1 in IHC, ELISA applications and shows reactivity with Mouse, human samples. Tested Applications Positive IHC detected in: mouse cerebellum tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information LRRCC1 (Leucine Rich Repeat And Coiled-Coil Centrosomal Protein 1) was Required for the organization of the mitotic spindle. Maintains the structural integrity of centrosomes during mitosis. Specification Tested Reactivity: Mouse, human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23522 Product name: Recombinant human LRRCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC030701 Sequence: MEAAAAVVAAEAEVENEDGDSSCGDVCFMDKGLQSISELSLDSTLHAVNLHCNNISKIEAIDHIWNLQHLDLSSNQISRIEGLNTLTKLCTLNLSCNLITKVEGLEELINLTRLNVSYNHVDDLSGLIPLHGIKHKLRYIDLHSNRIDSIHHLLQCMVGLHFLTNLILEKDGDDNPVCRLPGYRAVILQTLPQLRILDCKNIFGEPVNLTEINSSQLQCLEGLLDNLVSSDSPLNISEDEIIDRMPVITAPIDELVPLEQFASTPSDAVLTSFMSVCQSSEPEKNNHENDLQNEIKLQKLDDQILQLLNETSNSIDNVLEKDPRPKRDTDITSESDYGNRKEYNRKVPRRS Predict reactive species Full Name: leucine rich repeat and coiled-coil domain containing 1 GenBank Accession Number: BC030701 Gene Symbol: LRRCC1 Gene ID (NCBI): 85444 RRID: AB_3085856 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C099 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.