Iright
BRAND / VENDOR: Proteintech

Proteintech, 26344-1-AP, ZNF169 Polyclonal antibody

CATALOG NUMBER: 26344-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF169 (26344-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF169 in WB, ELISA applications with reactivity to human, mouse samples 26344-1-AP targets ZNF169 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse small intestine tissue, HeLa cells, HepG2 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ZNF169 (Zinc finger protein 169) is a 603 amino acid nuclear protein that contains one KRAB domain and thirteen C2H2-type zinc fingers. ZNF169 is highly expressed in kidney and weakly expressed in spleen, liver, small intestine and heart, where it functions as a transcription regulator. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23805 Product name: Recombinant human ZNF169 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 64-200 aa of BC047702 Sequence: NEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALSGHPTQIFPSSSAGGDFQLEAPRCSSEKGESGETEGPDSSLRKRPSRISRTFFSPHQGDPVEWVEGNREGGTDLRLAQRMSLGGSDTMLKGADTSESGAVI Predict reactive species Full Name: zinc finger protein 169 Observed Molecular Weight: 68 kDa GenBank Accession Number: BC047702 Gene Symbol: ZNF169 Gene ID (NCBI): 169841 RRID: AB_2880484 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14929 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924