Iright
BRAND / VENDOR: Proteintech

Proteintech, 26382-1-AP, GTF3C6 Polyclonal antibody

CATALOG NUMBER: 26382-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GTF3C6 (26382-1-AP) by Proteintech is a Polyclonal antibody targeting GTF3C6 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 26382-1-AP targets GTF3C6 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human urothelial carcinoma tissue, human lung cancer tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23895 Product name: Recombinant human GTF3C6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-213 aa of BC011593 Sequence: MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP Predict reactive species Full Name: general transcription factor IIIC, polypeptide 6, alpha 35kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC011593 Gene Symbol: GTF3C6 Gene ID (NCBI): 112495 RRID: AB_2880497 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969F1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924