Proteintech, 26384-1-AP, HOXB13 Polyclonal antibody

Size: 20ul / 150ul The HOXB13 (26384-1-AP) by Proteintech is a Polyclonal antibody targeting HOXB13 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 26384-1-AP targets HOXB13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, PC-3 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The homeobox (HOX) is a specific and widely distributed DNA sequence characterizing genes that are responsive to HOX transcription factors. Homeobox B13 (HOXB13) is one of the numerous DNA-binding transcription factors of the HOX gene family that has been implicated in the development of normal prostate and cancer (PMID: 25825985). In addition, high-level expression of HOXB13 is closely associated with tumor angiogenesis and poor prognosis of hepatocellular carcinoma(PMID: 25031711). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24757 Product name: Recombinant human HOXB13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC007092 Sequence: MEPGNYATLDGAKDIEGLLGAGGGRNLVAHSPLTSHPAAPTLMPAVNYAPLDLPGSAEPPKQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRH Predict reactive species Full Name: homeobox B13 Calculated Molecular Weight: 284 aa, 31 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC007092 Gene Symbol: HOXB13 Gene ID (NCBI): 10481 RRID: AB_3085864 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92826 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.