Iright
BRAND / VENDOR: Proteintech

Proteintech, 26399-1-AP, SLCO4A1 Polyclonal antibody

CATALOG NUMBER: 26399-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLCO4A1 (26399-1-AP) by Proteintech is a Polyclonal antibody targeting SLCO4A1 in WB, ELISA applications with reactivity to human samples 26399-1-AP targets SLCO4A1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLCO4A (Solute carrier organic anion transporter family member 4A1), also referred to as OATP4A1, is a membrane transporter protein, primarily facilitates the transmembrane transport of substances that are independent of Na+, including lipid‑soluble drugs, thyroid and adrenal hormones, and a selected few toxin (PMID: 38275113). SLCO4A1 is highly expressed in several cancers and promotes cell proliferation, migration and invasion (PMID: 28378090). Besides, SLCO4A1 was highly expressed in pancreatic cancer and could be a potential biomarker to target anticancer drugs to pancreatic carcinoma (PMID: 34924768). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23905 Product name: Recombinant human SLCO4A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC015727 Sequence: MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLCQLWAEKHGARGTHEVRYISAGQSVACGWWAFAPPCLQVLNTPK Predict reactive species Full Name: solute carrier organic anion transporter family, member 4A1 Calculated Molecular Weight: 77 kDa Observed Molecular Weight: 77 kDa GenBank Accession Number: BC015727 Gene Symbol: SLCO4A1 Gene ID (NCBI): 28231 RRID: AB_2880501 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924