Iright
BRAND / VENDOR: Proteintech

Proteintech, 26411-1-AP, Pan-Keratin Polyclonal antibody

CATALOG NUMBER: 26411-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Pan-Keratin (26411-1-AP) by Proteintech is a Polyclonal antibody targeting Pan-Keratin in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 26411-1-AP targets Pan-Keratin in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, MCF-7 cells, HeLa cells Positive IHC detected in: human oesophagus tissue, human brown disease, human cervical cancer tissue, human colon cancer tissue, human liver tissue, human lung cancer tissue, human renal cell carcinoma tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue, human rectal cancer tissue Positive IF/ICC detected in: A431 cells, HeLa cells, mouse breast cancer Recommended dilution Western Blot (WB): WB : 1:50000-1:200000 Immunohistochemistry (IHC): IHC : 1:1500-1:6000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Pan-keratin, also known as pan-cytokeratin, refers to a group of antibodies that recognize a broad array of keratin proteins. Keratins are a large family of intermediate filament (IF) proteins that provide structural integrity to epithelial cells. These proteins are essential for maintaining cell shape, strength, and resilience . The keratin gene family is divided into two major groups: type I keratins (acidic) and type II keratins (basic), with 27 type I and 26 type II keratin genes in humans. Pan-keratin immunostaining is widely used in pathology and research due to its ability to detect a variety of keratin proteins, making it a valuable tool for identifying epithelial cells and tissues. This staining technique is particularly useful in the diagnosis of tumors, as it can help distinguish between epithelial and non-epithelial neoplasms. This antibody is a pan-keratin antibody. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24184 Product name: Recombinant human KRT5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 316-491 aa of BC024292 Sequence: THVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNI Predict reactive species Full Name: keratin 5 Calculated Molecular Weight: 590 aa, 62 kDa Observed Molecular Weight: 46-58 kDa GenBank Accession Number: BC024292 Gene Symbol: Cytokeratin 5 Gene ID (NCBI): 3852 RRID: AB_2880505 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13647 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924