Proteintech, 26413-1-AP, FAM92B/CIBAR2 Polyclonal antibody

Size: 20ul / 150ul The FAM92B/CIBAR2 (26413-1-AP) by Proteintech is a Polyclonal antibody targeting FAM92B/CIBAR2 in WB, IF-P, ELISA applications with reactivity to human, mouse samples 26413-1-AP targets FAM92B/CIBAR2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells, mouse small intestine tissue Positive IF-P detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information FAM92B (family with sequence similarity 92, member B, also named CIBAR2) is a transmembrane protein that plays a crucial role in various cellular processes, including membrane trafficking and cell adhesion. The protein is predicted to be intracellular and is involved in ciliogenesis, likely through the recruitment and fusion of endosomal vesicles at distal appendages during early stages of ciliogenesis. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24802 Product name: Recombinant human FAM92B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-304 aa of BC111944 Sequence: VDSSRTTLQLEETVDGFQRQKLKDLQKFFCDFVTIEMVFHAKAVEVYSSAFQTLEKYDLERDLLDFRAKMQGVYGHYDTRLLANTSPPPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEWVVKGQPAHCVCGQGGHLMLPGHSL Predict reactive species Full Name: family with sequence similarity 92, member B Calculated Molecular Weight: 304 aa, 35 kDa Observed Molecular Weight: 32-35 kDa GenBank Accession Number: BC111944 Gene Symbol: FAM92B Gene ID (NCBI): 339145 RRID: AB_2880506 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZTR7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.