Iright
BRAND / VENDOR: Proteintech

Proteintech, 26415-1-AP, VEGFR2/KDR Polyclonal antibody

CATALOG NUMBER: 26415-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VEGFR2/KDR (26415-1-AP) by Proteintech is a Polyclonal antibody targeting VEGFR2/KDR in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 26415-1-AP targets VEGFR2/KDR in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human placenta tissue, mouse heart tissue, mouse lung tissue, mouse placenta tissue, rat lung tissue Positive IP detected in: human placenta tissue, rat skeletal muscle tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information KDR, also named as VEGFR-2, FLK1 and CD309, is a receptor for VEGF or VEGFC. KDR which belongs to the protein kinase superfamily, has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. KDR functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. Mutations of this gene are implicated in infantile capillary hemangiomas. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, canine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24589 Product name: Recombinant human KDR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1158-1345 aa of BC131822 Sequence: EHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQP Predict reactive species Full Name: kinase insert domain receptor (a type III receptor tyrosine kinase) Calculated Molecular Weight: 1356 aa, 152 kDa Observed Molecular Weight: 180-200 kDa, 230 kDa GenBank Accession Number: BC131822 Gene Symbol: KDR Gene ID (NCBI): 3791 RRID: AB_2756527 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P35968 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924