Proteintech, 26421-1-AP, ENAH Polyclonal antibody

Size: 20ul / 150ul The ENAH (26421-1-AP) by Proteintech is a Polyclonal antibody targeting ENAH in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26421-1-AP targets ENAH in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, U-251 cells, MCF-7 cells, HUVEC cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24200 Product name: Recombinant human ENAH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 501-577 aa of BC095481 Sequence: NTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEEL Predict reactive species Full Name: enabled homolog (Drosophila) Calculated Molecular Weight: 591 aa, 67 kDa Observed Molecular Weight: 85-88 kDa, 75-80 kDa GenBank Accession Number: BC095481 Gene Symbol: ENAH Gene ID (NCBI): 55740 RRID: AB_2880509 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N8S7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.