Proteintech, 26423-1-AP, SLC29A4 Polyclonal antibody

Size: 20ul / 150ul The SLC29A4 (26423-1-AP) by Proteintech is a Polyclonal antibody targeting SLC29A4 in IHC, ELISA applications with reactivity to human, rat samples 26423-1-AP targets SLC29A4 in IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC29A4 encodes for an integral plasma membrane protein known as PMAT (Plasma Membrane Monoamine Transporter) or ENT4 (Equilibrative Nucleoside Transporter 4) (PMID: 32170814). SLC29A4 contributes to dopamine and serotonin uptake (PMID: 29797618). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24869 Product name: Recombinant human SLC29A4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 239-337 aa of BC025325 Sequence: RRSRFVLFYTTRPRDSHRGRPGLGRGYGYRVHHDVVAGDVHFEHPAPALAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLHRYVVAR Predict reactive species Full Name: solute carrier family 29 (nucleoside transporters), member 4 GenBank Accession Number: BC025325 Gene Symbol: SLC29A4 Gene ID (NCBI): 222962 RRID: AB_3085868 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7RTT9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.