Proteintech, 26426-1-AP, KCNH1 Polyclonal antibody

Size: 20ul / 150ul The KCNH1 (26426-1-AP) by Proteintech is a Polyclonal antibody targeting KCNH1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26426-1-AP targets KCNH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Potassium voltage-gated channel subfamily H member 1 (KCNH1, also known as Kv10.1 and EAG) a member of the EAG (ether-à-go-go) family, which is involved in intracellular signaling, cell proliferation, and tumorigenesis (PMID: 35639255). KCNH1 is mainly expressed in the adult central nervous system. It also plays a role in controlling K+ fux that regulates resting membrane potential in excitable and non-excitable cells and is activated at the onset of myoblast differentiation (PMID: 29333676; 27029528; 9738473). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16647 Product name: Recombinant human KCNH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 686-850 aa of BC113709 Sequence: VKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNVLTEHASANHSLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKT Predict reactive species Full Name: potassium voltage-gated channel, subfamily H (eag-related), member 1 Calculated Molecular Weight: 989 aa, 111 kDa Observed Molecular Weight: 111 kDa GenBank Accession Number: BC113709 Gene Symbol: KCNH1 Gene ID (NCBI): 3756 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95259 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.