Proteintech, 26430-1-AP, BOK Polyclonal antibody

Size: 20ul / 150ul The BOK (26430-1-AP) by Proteintech is a Polyclonal antibody targeting BOK in WB, FC (Intra), ELISA applications with reactivity to human samples 26430-1-AP targets BOK in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information BOK belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has restricted expression in reproductive tissues, interacts strongly with some antiapoptotic BCL2 proteins, not at all with proapoptotic BCL2 proteins, and induces apoptosis in transfected cells. Thus, this protein represents a proapoptotic member of the BCL2 family. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24070 Product name: Recombinant human BOK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC006203 Sequence: MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMIR Predict reactive species Full Name: BCL2-related ovarian killer Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC006203 Gene Symbol: BOK Gene ID (NCBI): 666 RRID: AB_3085869 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UMX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.