Proteintech, 26438-1-AP, 5HT2A Receptor Polyclonal antibody

Size: 20ul / 150ul The 5HT2A Receptor (26438-1-AP) by Proteintech is a Polyclonal antibody targeting 5HT2A Receptor in IHC, ELISA applications with reactivity to human samples 26438-1-AP targets 5HT2A Receptor in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human brain tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The 5HT2A Receptor gene (HTR2A) codes for a G-protein coupled receptor and belongs to the G-protein coupled receptor 1 family. HTR2A plays a key role in serotonin pathway regulation. HTR2A affects neural activity, perception, cognition, and mood and functions as the main target of atypical antipsychotic drugs (PMID: 17691947, 21550210). 5HT2A Receptor has 2 isoforms with the molecular mass of 44 and 53 kDa. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24056 Product name: Recombinant human HTR2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 387-471 aa of BC074848 Sequence: YRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV Predict reactive species Full Name: 5-hydroxytryptamine (serotonin) receptor 2A Calculated Molecular Weight: 471 aa, 53 kDa GenBank Accession Number: BC074848 Gene Symbol: 5HT2A Receptor Gene ID (NCBI): 3356 RRID: AB_3085872 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28223 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.