Product Description
Size: 20ul / 150ul
The NME7 (26449-1-AP) by Proteintech is a Polyclonal antibody targeting NME7 in WB, IHC, ELISA applications with reactivity to human, mouse samples
26449-1-AP targets NME7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse embryo tissue
Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
NME7, also named as NDK7, nm23-H7, plays the major role in the synthesis of nucleoside triphosphates other than ATP. NME7 has two isoforms with MW 38-42 kDa.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24918 Product name: Recombinant human NME7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC006983 Sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSR Predict reactive species
Full Name: non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
Calculated Molecular Weight: 376 aa, 42 kDa
Observed Molecular Weight: 38-42 kDa
GenBank Accession Number: BC006983
Gene Symbol: NME7
Gene ID (NCBI): 29922
RRID: AB_2880517
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y5B8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924