Proteintech, 26454-1-AP, MOS Polyclonal antibody

Size: 20ul / 150ul The MOS (26454-1-AP) by Proteintech is a Polyclonal antibody targeting MOS in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 26454-1-AP targets MOS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HEK-293 cells, Jurkat cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Mos is a germ cell-specific serine/threonine protein kinase, can induce oncogenic transformation of somatic cells by direct phosphorylation of MAP kinase/ERK kinase (MEK1), activating the mitogen-activated protein kinases ERK1 and ERK2. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24585 Product name: Recombinant human MOS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-150 aa of BC069569 Sequence: PAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQV Predict reactive species Full Name: v-mos Moloney murine sarcoma viral oncogene homolog Calculated Molecular Weight: 346 aa, 38 kDa Observed Molecular Weight: 34-38 kDa GenBank Accession Number: BC069569 Gene Symbol: MOS Gene ID (NCBI): 4342 RRID: AB_3085874 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00540 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.