Iright
BRAND / VENDOR: Proteintech

Proteintech, 26455-1-AP, CD85j / LILRB1 Polyclonal antibody

CATALOG NUMBER: 26455-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CD85j / LILRB1 (26455-1-AP) by Proteintech is a Polyclonal antibody targeting CD85j / LILRB1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples 26455-1-AP targets CD85j / LILRB1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells, Ramos cells Positive IHC detected in: human liver tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information LILRB1, also named as CD85j or ILT2, includes four C2 Ig domains binding HLA class I molecules in the extracellular region and a cytoplasmic domain containing four immunoreceptor tyrosine-based inhibition motifs (ITIM). LILRB1 is a surface glycoprotein detected on the surface of B cells, monocytes, dendritic cells, T cells and NK cells. The predicted MW of LILRB1 is 71 kDa and 26455-1-AP antibody recognizes the 71 and 110 kDa which might be the noncovalently linked monomer. (PMID:17601702; 15474475; 17549736; 24098421) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24795 Product name: Recombinant human LILRB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 137-241 aa of BC015731 Sequence: SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET Predict reactive species Full Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1 Calculated Molecular Weight: 71 kDa Observed Molecular Weight: 71 and 110 kDa GenBank Accession Number: BC015731 Gene Symbol: LILRB1 Gene ID (NCBI): 10859 RRID: AB_2880518 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NHL6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924