Iright
BRAND / VENDOR: Proteintech

Proteintech, 26468-1-AP, ERF Polyclonal antibody

CATALOG NUMBER: 26468-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ERF (26468-1-AP) by Proteintech is a Polyclonal antibody targeting ERF in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 26468-1-AP targets ERF in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, J774A.1 cells, RAW 264.7 cells Positive IP detected in: A431 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ERF (Ets2 repressor factor) is also named as PE-2. Erf is a gene for a ubiquitously expressed Ets DNA-binding domain-containing transcriptional repressor regulated by Erk-dependent phosphorylation (PMID: 28694332, PMID: 35258130). Erf is involved in T cell maturation, acting as a positive regulator during CD4 and eventually CD8 lineage commitment, while negatively regulates the production of γδ T cells (PMID: 35258130). Erf is required for both primitive and erythromyeloid progenitor waves of hematopoietic stem cell (HSC)-independent hematopoiesis as well as for the normal function of HSCs (PMID: 28694332). ETS2 repressor factor (ERF) insufficiency causes craniosynostosis (CRS4) in humans and mice. ERF is an ETS domain transcriptional repressor regulated by Erk1/2 phosphorylation via nucleo-cytoplasmic shuttling (PMID: 37175668). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24189 Product name: Recombinant human ERF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 138-323 aa of BC022231 Sequence: GGSHFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARRLGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSGGGGPSGSGGGSHFSFSPEDMKRYLQAHTQSVYN Predict reactive species Full Name: Ets2 repressor factor Calculated Molecular Weight: 548 aa, 59 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC022231 Gene Symbol: ERF Gene ID (NCBI): 2077 RRID: AB_3669537 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P50548 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924