Proteintech, 26471-1-AP, MC1R Polyclonal antibody

Size: 20ul / 150ul The MC1R (26471-1-AP) by Proteintech is a Polyclonal antibody targeting MC1R in IHC, IF/ICC, ELISA applications with reactivity to human samples 26471-1-AP targets MC1R in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24006 Product name: Recombinant human MC1R protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 156-243 aa of BC080622 Sequence: VTLPRARRAVAAIWVASVVFSTLFIAYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGAVTL Predict reactive species Full Name: melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor) Calculated Molecular Weight: 35 kDa GenBank Accession Number: BC080622 Gene Symbol: MC1R Gene ID (NCBI): 4157 RRID: AB_2880529 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q01726 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.