Iright
BRAND / VENDOR: Proteintech

Proteintech, 26484-1-AP, GNB1L Polyclonal antibody

CATALOG NUMBER: 26484-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GNB1L (26484-1-AP) by Proteintech is a Polyclonal antibody targeting GNB1L in WB, ELISA applications with reactivity to human samples 26484-1-AP targets GNB1L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information GNB1L (G-protein subunit beta 1 like), located at 22q11.2, encodes a G-protein L-subunit-like polypeptide which is a member of the WD repeat protein family (PMID: 20538345). In humans, the hemizygous deletion of GNB1L can cause sensorimotor gating defects, which are related to schizophrenia and other serious mental diseases (PMID: 32847500). Moreover, GNB1L is a key regulator of DDR signaling via its role as a co-chaperone specifically regulating PIKK proteins (PMID: 37541219). GNB1L has 2 isoforms 36 kDa and 22 kDa, about 22 kDa which may be produced by Alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24391 Product name: Recombinant human GNB1L protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 187-278 aa of BC012060 Sequence: DGSVVLWDVSEQKVCSRIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDWQQALQVRGTHELTNPGIAEVTIRPDRKILATAGWDHRIR Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 1-like Calculated Molecular Weight: 327 aa, 36 kDa Observed Molecular Weight: 36 kDa, 18 kDa GenBank Accession Number: BC012060 Gene Symbol: GNB1L Gene ID (NCBI): 54584 RRID: AB_3085876 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYB4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924