Iright
BRAND / VENDOR: Proteintech

Proteintech, 26488-1-AP, Macoilin Polyclonal antibody

CATALOG NUMBER: 26488-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Macoilin (26488-1-AP) by Proteintech is a Polyclonal antibody targeting Macoilin in IP, ELISA applications with reactivity to human samples 26488-1-AP targets Macoilin in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: Neuro-2a cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24428 Product name: Recombinant human TMEM57 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 497-664 aa of BC032427 Sequence: ASRGECTETLRNRIRELEAEGKKLTMDMKVKEDQIRELELKVQELRKYKENEKDTEVLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKDLKQKIAEVMAVMPSITYSAATSPLSPVSPHYSSKFVETSPSGLDPNASVYQPLKK Predict reactive species Full Name: transmembrane protein 57 Calculated Molecular Weight: 664 aa, 76 kDa Observed Molecular Weight: 76 kDa GenBank Accession Number: BC032427 Gene Symbol: TMEM57 Gene ID (NCBI): 55219 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5G2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924